Recombinant Brucella abortus biovar 1 Beta- (1-->2)glucan export ATP-binding/permease protein NdvA

Shipped with Ice Packs
In Stock

Description

Functional Role in Brucella Pathogenesis

NdvA is homologous to Sinorhizobium meliloti NdvA and Agrobacterium tumefaciens ChvA, which are involved in cyclic β-1,2-glucan synthesis and export. In Brucella abortus, cyclic β-1,2-glucan:

  • Modulates Host Immunity: Inhibits phagolysosome fusion and reactive oxygen species (ROS) production, enabling intracellular survival .

  • Supports Virulence: Mutants lacking functional NdvA exhibit reduced cyclic β-1,2-glucan production, impaired intracellular replication in macrophages, and attenuated virulence in mice .

Homology and Complementation
NdvA shares 58.5% and 59.9% amino acid identity with S. meliloti NdvA and A. tumefaciens ChvA, respectively. B. abortus cgt (a homolog of NdvA) restores motility, nodule formation, and virulence in mutants of S. meliloti and A. tumefaciens .

Vaccine Development

NdvA is explored as a subunit vaccine candidate due to its role in pathogenicity. Key studies include:

Study FocusKey FindingsSource
Subunit Vaccine PotentialRecombinant NdvA reacts with Brucella-positive sera, indicating immunogenicity.
Combined Vaccine StrategiesCo-administration with Omp16, Omp19, Omp28, and L7/L12 ribosomal proteins enhances Th1 responses and protection in murine models.
Live Attenuated vs. SubunitLive vaccines (e.g., RB51) remain more effective, but NdvA-based subunit vaccines avoid reversion risks.

Molecular Mechanisms

  • ATP-Binding and Transport: NdvA’s ATPase domain hydrolyzes ATP to drive cyclic β-1,2-glucan export, a process critical for periplasmic osmotic balance and host cell invasion .

  • Impact of Deletion: B. abortus cgt mutants show reduced cyclic β-1,2-glucan levels (<15% of wild-type), correlating with defective intracellular survival .

Comparative Analysis with Other Brucella Antigens

NdvA’s utility in vaccine development is compared to other Brucella proteins:

AntigenRoleVaccine EfficacySource
NdvACyclic β-1,2-glucan exportModerate (subunit)
Omp16/Omp19/Omp28Outer membrane proteinsStrong (combined subunits)
L7/L12Ribosomal proteinStrong (Th1 induction)
Glucokinase (r-glk)Metabolic enzymePartial (Th1 response)

Challenges and Future Directions

  • Efficacy Limitations: Subunit vaccines like NdvA often elicit weaker responses than live attenuated vaccines, necessitating adjuvants or combination strategies .

  • Targeted Drug Development: Inhibiting NdvA’s ATP-binding domain could disrupt cyclic β-1,2-glucan export, but no small-molecule inhibitors are yet reported.

  • Diagnostic Potential: NdvA-specific antibodies may aid in differentiating infected vs. vaccinated animals (DIVA) in serological tests .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndvA; BruAb1_1004; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
ndvA
Target Protein Sequence
MSLLKIYWRAMQYLAVERTATITMCVASVLVALVTLAEPVLFGRVIQSISDKGDIFSPLL MWAALGGFNIMAAVFVARGADRLAHRRRLGVMIDSYERLITMPLAWHQKRGTSNALHTLI RATDSLFTLWLEFMRQHLTTVVALATLIPVAMTMDMRMSLVLIVLGVIYVMIGQLVMRKT KDGQAAVEKHHHKLFEHVSDTISNVSVVQSYNRIASETQALRDYAKNLENAQFPVLNWWA LASGLNRMASTFSMVVVLVLGAYFVTKGQMRVGDVIAFIGFAQLMIGRLDQISAFINQTV TARAKLEEFFQMEDATADRQEPENVADLNDVKGDIVFDNVTYEFPNSGQGVYDVSFEVKP GQTVAIVGPTGAGKTTLINLLQRVFDPAAGRIMIDGTDTRTVSRRSLRHAIATVFQDAGL FNRSVEDNIRVGRANATHEEVHAAAKAAAAHDFILAKSEGYDTFVGERGSQLSGGERQRL AIARAILKDSPILVLDEATSALDVETEEKVTQAVDELSHNRTTFIIAHRLSTVRSADLVL FMDKGHLVESGSFNELAERGGRFSDLLRAGGLKLEDKQPKQPVVEGSNVMPFPVKGAVA
Uniprot No.

Target Background

Function

Function: Involved in β-(1→2)-glucan export. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides energy for the process.

Database Links
Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the most effective expression systems for producing recombinant NdvA protein?

Based on research with similar Brucella proteins, E. coli expression systems (particularly BL21(DE3) strains) have proven effective for producing recombinant Brucella proteins like NdvA . For membrane proteins such as NdvA, specialized E. coli strains designed for membrane protein expression may yield better results. When using E. coli systems, optimizing induction conditions (IPTG concentration, temperature, and induction time) is critical to prevent formation of inclusion bodies. For functional studies, yeast expression systems (Pichia pastoris or Saccharomyces cerevisiae) may provide better post-translational processing. Expression in a cell-free system is another alternative, particularly useful when toxicity is an issue in cellular systems.

What purification strategies yield the highest purity and activity for recombinant NdvA?

A multi-step purification approach is recommended for recombinant NdvA:

  • Initial extraction using detergent solubilization (commonly n-dodecyl-β-D-maltoside or CHAPS) is crucial for this membrane-associated protein.

  • Affinity chromatography (if His-tagged) using Ni-NTA columns under optimized imidazole gradients.

  • Ion exchange chromatography as a secondary purification step.

  • Size exclusion chromatography for final polishing and to verify oligomeric state.

Maintaining the cold chain (4°C) throughout purification and including protease inhibitors in all buffers is essential for preserving activity. ATP binding activity can be verified using fluorescent ATP analogs, and transport function can be assessed through reconstitution in liposomes followed by transport assays. Typical yields range from 1-5 mg of purified protein per liter of bacterial culture, with purity exceeding 95% as assessed by SDS-PAGE .

How can I design an effective immunization protocol using recombinant NdvA for protective immunity studies?

Based on successful immunization protocols with other Brucella recombinant proteins, a recommended approach would be:

  • Prepare highly purified recombinant NdvA (>95% purity) in a buffer compatible with in vivo administration.

  • Administer 30-50 μg of protein per mouse (for BALB/c mice) emulsified with an appropriate adjuvant such as incomplete Freund's adjuvant for initial immunization .

  • Perform booster immunizations at days 15 and 30 with the same protein dose.

  • Collect serum samples at days 0, 15, 30, and 45 to monitor antibody development.

  • Challenge with virulent B. abortus 2-4 weeks after final immunization.

This protocol has shown success with recombinant Omp31, inducing both humoral and cell-mediated immunity. For NdvA specifically, monitoring both IgG1 and IgG2a antibody responses would be important to assess the balance between Th1 and Th2 immune responses . Additionally, assessment of cytokine profiles (IFN-γ, IL-2, IL-4, and IL-10) from stimulated splenocytes should be performed to characterize the type of T-helper response elicited.

What are the optimal conditions for assessing NdvA-mediated Beta-(1-->2)glucan transport in vitro?

For in vitro transport assays with recombinant NdvA:

  • Reconstitute purified NdvA in proteoliposomes composed of E. coli lipids and phosphatidylcholine (7:3 ratio).

  • Prepare inside-out membrane vesicles containing properly oriented NdvA.

  • Initiate transport by adding ATP (typically 5 mM) and radiolabeled or fluorescently-labeled Beta-(1-->2)glucan substrate.

  • Monitor transport at physiological temperature (37°C) over time intervals (0-60 minutes).

  • Use ATP analogs (AMP-PNP) or ATP depletion systems as negative controls.

  • Employ rapid filtration or centrifugation to separate vesicles from external medium.

Transport activity is typically measured as nmol of glucan transported per mg of protein per minute. The assay should include controls with transport inhibitors such as vanadate (P-type ATPase inhibitor) and competitive substrates to confirm specificity. Temperature dependence (25-42°C range) and pH dependence (pH 5.5-8.0 range) should also be assessed to determine optimal conditions.

How can I differentiate between NdvA-specific immune responses and cross-reactivity with other Brucella proteins?

Distinguishing NdvA-specific immune responses requires several analytical approaches:

  • Pre-absorb test sera with other purified Brucella proteins to remove cross-reactive antibodies before assessing NdvA-specific binding.

  • Employ competitive ELISA assays using peptide fragments unique to NdvA.

  • Use Western blotting with both recombinant NdvA and whole Brucella lysates to identify cross-reactive bands.

  • Perform epitope mapping of antibody responses to identify NdvA-specific epitopes versus conserved epitopes shared with other proteins.

  • Include sera from animals infected with related bacterial species to identify genus-specific versus species-specific responses.

Analysis of T-cell responses requires similar differentiation approaches using:

  • Stimulation with overlapping peptides specific to NdvA

  • Flow cytometry with intracellular cytokine staining to identify antigen-specific T cells

  • ELISpot assays with various antigens to assess cross-reactivity at the cellular level

What statistical approaches are most appropriate for analyzing NdvA vaccination efficacy data?

For analyzing NdvA vaccination efficacy data:

  • Use log transformation of bacterial counts (CFU) from protection studies, as bacterial loads typically follow log-normal distribution.

  • Apply non-parametric tests (Mann-Whitney U test) for comparing bacterial loads between vaccinated and control groups when normality cannot be assumed.

  • For antibody titers, use geometric means rather than arithmetic means, with 95% confidence intervals.

  • For survival studies, employ Kaplan-Meier survival analysis with log-rank test for comparing groups.

  • Calculate protection units as the difference between mean log CFU in control versus vaccinated groups.

Statistical MeasureApplicationThreshold for Significance
Mann-Whitney U testBacterial loads comparisonp < 0.05
Student's t-test (on log-transformed data)Antibody titersp < 0.05
Log-rank testSurvival analysisp < 0.05
One-way ANOVA with Tukey's post-hocMultiple group comparisonp < 0.05
Protection unitsVaccine efficacy>2.0 log units considered significant protection

Additionally, correlation analyses between antibody titers, cytokine levels, and protection outcomes should be performed using Spearman's rank correlation coefficient .

How do I interpret contradictory results between in vitro NdvA activity and in vivo protection studies?

Discrepancies between in vitro activity and in vivo protection are common in Brucella vaccine research and require careful analysis:

  • Consider compartmentalization of immune responses: NdvA may show strong in vitro activity but poor in vivo efficacy if it fails to induce the right type of response in relevant anatomical locations.

  • Analyze the balance between humoral and cell-mediated immunity: Effective protection against Brucella requires primarily a Th1-dominated response (IFN-γ, IL-2) rather than antibody production alone .

  • Examine timing of immune response relative to challenge: Strong initial responses may wane before challenge.

  • Evaluate diversity of the T-cell repertoire: Limited epitope recognition may reduce protection despite strong responses to specific epitopes.

  • Assess potential immune evasion mechanisms that operate in vivo but not in vitro.

When faced with contradictions, additional experiments should include:

  • Adoptive transfer studies to determine protective cellular components

  • Cytokine neutralization studies to determine critical immune mediators

  • Time-course studies to map correlation between immune parameters and protection

  • Challenge with different Brucella strains to assess cross-protection

How does the genetic variability in ndvA genes across Brucella abortus strains affect protein function and vaccine potential?

Genetic variability in ndvA among B. abortus strains primarily affects:

  • Binding affinity for ATP and beta-glucan substrates due to mutations in the nucleotide-binding domains.

  • Transport efficiency related to variations in the transmembrane domains.

  • Protein stability and half-life in different environmental conditions.

  • Immunogenicity due to epitope variations in surface-exposed regions.

Comprehensive sequence analysis of ndvA from multiple B. abortus isolates reveals conserved regions corresponding to functional domains and variable regions that may impact strain-specific virulence. When developing recombinant NdvA vaccines, focusing on conserved regions provides broader protection, while strain-specific variants might offer enhanced protection against particular regional strains. Phylogenetic analysis of ndvA sequences correlates with virulence variations among strains, with key mutations in ATP-binding sites particularly relevant to functional differences .

What role does NdvA play in Brucella's interaction with host immune system components?

NdvA's role in Brucella-host immune interactions is multifaceted:

  • The exported Beta-(1-->2)glucan modulates phagosome-lysosome fusion in macrophages, contributing to intracellular survival.

  • NdvA-dependent glucan export affects membrane properties that influence recognition by pattern recognition receptors.

  • Beta-(1-->2)glucans interact with host C-type lectin receptors, potentially modulating dendritic cell activation.

  • The transport activity influences the composition of the bacterial envelope, affecting recognition by complement and antibodies.

Research indicates that mutations in ndvA result in altered cytokine profiles during infection, particularly decreased IL-12 and increased IL-10 production, shifting the immune response away from protective Th1 responses. Furthermore, NdvA activity influences the presentation of other Brucella antigens by affecting membrane organization and vesicle formation. This protein represents a critical link between bacterial physiology and immunomodulation .

How can protein-protein interaction studies of NdvA inform novel therapeutic approaches against brucellosis?

Protein-protein interaction studies with NdvA can reveal:

  • Interactions with other bacterial proteins involved in virulence and membrane transport complexes.

  • Binding to host cellular proteins during infection.

  • Potential for targeting by small molecule inhibitors that disrupt essential interactions.

  • Structural domains critical for oligomerization and function.

Similar to studies with NDV viral proteins and their host interactions, systematic analysis of NdvA interactions can identify therapeutic targets . Approaches should include:

  • Yeast two-hybrid screening to identify interaction partners

  • Co-immunoprecipitation followed by mass spectrometry

  • Surface plasmon resonance to quantify binding affinities

  • FRET/BRET assays to detect interactions in living cells

The following table summarizes potential therapeutic approaches based on NdvA interactions:

Interaction TypeTherapeutic ApproachAdvantageChallenge
NdvA-ATP interactionCompetitive ATP analogsDirect inhibition of transport functionSpecificity versus host ATP-binding proteins
NdvA oligomerizationPeptide inhibitors of multimerizationDisruption of functional complexesDelivery across bacterial membranes
NdvA-substrate bindingModified glucan analogsCompetitive inhibitionDesigning analogs with appropriate specificity
NdvA-host protein interactionsBlocking antibodies or peptidesPrevention of host manipulationIdentifying accessible epitopes

These approaches could lead to novel anti-virulence therapeutics that don't rely on conventional antibiotics, potentially addressing concerns about antimicrobial resistance .

What are the key considerations for designing NdvA knockout and complementation studies?

When designing genetic manipulation studies for ndvA:

  • Knockout strategy:

    • Use unmarked deletion rather than insertion inactivation to avoid polar effects on downstream genes.

    • Consider creating conditional knockouts if ndvA is essential for viability.

    • Verify knockouts by both PCR and Western blotting to confirm absence of protein expression.

  • Complementation approach:

    • Use low to medium-copy plasmids with native promoters for physiological expression levels.

    • Include epitope tags that don't interfere with function for distinguishing complemented protein.

    • Create point mutations in key functional domains (Walker A and B motifs) as negative controls.

  • Phenotypic analysis:

    • Assess growth in various media conditions, particularly under stress conditions.

    • Measure Beta-(1-->2)glucan in membrane fractions and culture supernatants.

    • Evaluate survival in macrophage infection models and mouse virulence studies.

    • Test sensitivity to various antimicrobial compounds and host defense peptides .

The knockout/complementation system provides the gold standard for verifying protein function and can be used to evaluate the importance of specific domains through targeted mutagenesis.

How should epitope mapping of NdvA be approached to identify immunodominant regions for vaccine development?

A comprehensive epitope mapping approach for NdvA should include:

  • In silico analysis:

    • B-cell epitope prediction using algorithms like BepiPred, ABCpred, and Ellipro

    • T-cell epitope prediction using tools like NetMHC, IEDB, and SYFPEITHI

    • Structural modeling to identify surface-exposed regions

  • Experimental validation:

    • Overlapping peptide library scanning (15-20 amino acids with 5-10 residue overlaps)

    • ELISA with peptide-coated plates against sera from infected or immunized animals

    • ELISpot assays to identify T-cell epitopes using splenocytes from immunized animals

  • Epitope characterization:

    • Assess conservation across Brucella species and strains

    • Determine MHC binding affinity for identified T-cell epitopes

    • Evaluate cross-reactivity with other bacterial proteins

  • Validation in animal models:

    • Immunize with synthetic peptides or epitope-focused recombinant constructs

    • Evaluate protective efficacy against challenge

    • Determine correlation between epitope-specific responses and protection

This systematic approach has successfully identified protective epitopes in other Brucella proteins, such as a 27-amino acid peptide from Omp31 that provides protection similar to the whole protein .

What emerging technologies could advance NdvA research in the next five years?

Several cutting-edge technologies are poised to transform NdvA research:

  • Cryo-EM for membrane protein structural analysis:

    • High-resolution structural determination of NdvA in different conformational states during the transport cycle

    • Visualization of NdvA-substrate complexes to understand binding and transport mechanisms

  • CRISPR-Cas9 genome editing in Brucella:

    • Precise modification of ndvA regulatory regions to study expression control

    • Introduction of subtle mutations to map structure-function relationships in vivo

  • Single-cell technologies:

    • Tracking NdvA activity in individual bacteria during infection

    • Correlating NdvA function with bacterial survival in different host cell types

  • Nanobody and synthetic antibody development:

    • Generation of inhibitory nanobodies that block specific NdvA functions

    • Development of conformation-specific binders for structural studies

  • Systems biology approaches:

    • Multi-omics integration to understand NdvA's role in the broader context of Brucella physiology

    • Network analysis to identify key interactions and regulatory mechanisms

These technologies will help address fundamental questions about NdvA function and facilitate the development of more effective vaccines and therapeutics targeting this important virulence factor .

How can knowledge about NdvA be translated into practical applications for brucellosis control?

Translational applications of NdvA research include:

  • Subunit vaccine development:

    • Incorporation of immunodominant NdvA epitopes into multi-epitope vaccines

    • Development of vectored vaccines expressing optimized NdvA constructs

    • Adjuvant selection to promote appropriate Th1-biased responses against NdvA

  • Diagnostic tool development:

    • NdvA-based serological assays for detecting Brucella infection

    • PCR-based assays targeting ndvA sequence variations for strain typing

    • Point-of-care tests using NdvA-specific aptamers or antibodies

  • Therapeutic development:

    • Small molecule inhibitors of NdvA transport function

    • Peptide-based inhibitors targeting crucial protein-protein interactions

    • Combination approaches targeting multiple virulence systems including NdvA

  • Surveillance applications:

    • Monitoring ndvA sequence variations in field isolates to track strain evolution

    • Assessment of NdvA-based immunity in vaccinated herds

    • Environmental detection of Brucella based on ndvA sequences

The translation of basic NdvA research into these applications requires collaborative efforts between academic researchers, veterinary professionals, and industry partners to bridge the gap between laboratory findings and field implementation.

What is the optimal protocol for evaluating cellular immune responses to NdvA in vaccinated animals?

A comprehensive protocol for assessing NdvA-specific cellular immunity includes:

  • Splenocyte isolation and stimulation:

    • Harvest spleens from vaccinated and control animals at days 15, 30, and 45 post-vaccination

    • Prepare single-cell suspensions (3×10^6 cells/ml) in complete RPMI medium

    • Stimulate with purified recombinant NdvA (5 μg/ml) for 48-72 hours at 37°C, 5% CO2

    • Include positive controls (ConA, 5 μg/ml) and negative controls (medium alone)

  • Cytokine analysis:

    • Collect supernatants for ELISA measurement of IFN-γ, IL-2, IL-4, and IL-10

    • Perform intracellular cytokine staining with fluorochrome-conjugated antibodies

    • Analyze by flow cytometry to identify CD4+ and CD8+ T cell subsets producing cytokines

  • Proliferation assays:

    • Label cells with CFSE prior to antigen stimulation

    • Assess proliferation by flow cytometry after 72-96 hours

    • Calculate stimulation indices relative to unstimulated controls

  • Cytotoxicity assays:

    • Prepare target cells expressing NdvA (transfected macrophages or Brucella-infected cells)

    • Co-culture with effector T cells at various ratios

    • Measure specific lysis using LDH release or flow cytometry-based methods

This protocol has successfully demonstrated that rOmp31 induces a Th1-biased response with significant IFN-γ and IL-2 production but minimal IL-10 and IL-4, correlating with protection against Brucella challenge .

How can I develop a high-throughput screening assay to identify inhibitors of NdvA function?

A robust high-throughput screening platform for NdvA inhibitors would include:

  • Primary ATPase activity assay:

    • Express and purify recombinant NdvA in sufficient quantities

    • Establish a colorimetric or fluorescent ATPase assay in 384-well format

    • Optimize buffer conditions, protein concentration, and substrate concentration

    • Develop appropriate positive controls (known ATPase inhibitors) and negative controls

    • Validate with Z' factor > 0.5 for statistical robustness

  • Secondary transport assay:

    • Reconstitute NdvA in liposomes loaded with fluorescent Beta-(1-->2)glucan substrate

    • Measure transport activity through fluorescence quenching or FRET-based approaches

    • Confirm hits from primary screen in this more physiologically relevant assay

  • Counter-screens:

    • Test compounds against unrelated ATPases to establish selectivity

    • Assess cytotoxicity against mammalian cells

    • Evaluate membrane-disrupting properties of compounds

  • Tertiary bacterial assays:

    • Determine MICs against Brucella cultures

    • Assess effects on Beta-(1-->2)glucan export in whole bacteria

    • Evaluate impact on bacterial survival in macrophage infection models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.